General Information

  • ID:  hor007285
  • Uniprot ID:  Q9TU09??14-145)
  • Protein name:  Leptin
  • Gene name:  NA
  • Organism:  Equus caballus
  • Family:  Leptin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0051428 peptide hormone receptor binding; GO:0005179 hormone activity
  • GO CC:  GO:0043410 positive regulation of MAPK cascade; GO:1900745 positive regulation of p38MAPK cascade; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT; GO:0042102 positive regulation of T cell proliferation; GO:0032008 positive regulation of TOR signaling; GO:0032760 positive regulation of tumor necrosis factor production; GO:0046850 regulation of bone remodeling; GO:0045765 regulation of angiogenesis; GO:0090335 regulation of brown fat cell differentiation; GO:0051726 regulation of cell cycle; GO:1900015 regulation of cytokine production involved in inflammatory response; GO:0001936 regulation of endothelial cell proliferation; GO:0032814 regulation of natural killer cell activation; GO:0042269 regulation of natural killer cell mediated cytotoxicity; GO:0032817 regulation of natural killer cell proliferation; GO:0050999 regulation of nitric-oxide synthase activit

Sequence Information

  • Sequence:  PIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARGLETLASLGGVLEASLLLHRGGSPEQAAGVS
  • Length:  132
  • Propeptide:  LWLWPYLFFIEAVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARGLETLASLGGVLEASLLLHRGGSPEQAAGVS
  • Signal peptide:  LWLWPYLFFIEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA